Cell-Penetrating Peptides

Version	Summary	Created by	Modification	Content Size	Created at	Operation
1		Gandhi Rádis-Baptista	+ 2639 word(s)	2639	2021-03-02 08:48:36	\|
2	format correct	Vivi Li	Meta information modification	2639	2021-03-12 05:16:39	\|

This entry is adapted from the peer-reviewed paper 10.3390/toxins13020147

Cell-penetrating peptides (CPPs) comprise a class of short polypeptides that possess the ability to selectively interact with the cytoplasmic membrane of certain cell types, translocate across plasma membranes and accumulate in the cell cytoplasm, organelles (e.g., the nucleus and mitochondria), and other subcellular compartments. CPPs are either of natural origin or de novo designed and synthesized from segments and patches of larger proteins or designed by algorithms. With such intrinsic characteristics, along with membrane permeation, translocation, and cellular uptake properties, CPPs can intracellularly convey diverse substances and nanomaterials, such as hydrophilic organic compounds and drugs, macromolecules (nucleic acids and proteins), nanoparticles (nanocrystals and polyplexes), metals and radionuclides, which can be covalently attached via CPP N- and C-terminals or through the preparation of CPP complexes. A cumulative number of studies on animal toxins, primarily isolated from the venom of arthropods and snakes, have revealed the cell-penetrating activities of venom peptides and toxins, which can be harnessed for application in biomedicine and pharmaceutical biotechnology.

cell-penetrating peptide venom peptide arachnid venom peptide insect venom peptide snake venom peptide cellular uptake peptide chemical modification peptide engineering peptide design peptide carrier

1. Introduction

It has been established that the more diverse a biome is, the more intricate is the chemical-ecological relationships among organisms sharing the same niche and richer is the diversity of molecules and pharmacological activities that these co-inhabiting organisms contain. Indeed, a great probability of success in the drug discovery process from nature is connected to maximal biodiversity and chemical diversity ^[1].

Animal venoms and skin secretions are rich biological materials that contain a blend of biologically and pharmacologically active components, used by venomous and poisonous organisms for defense, predation and territorial disputes. The mechanisms via which these organisms deliver toxic components are related to how toxins have evolved and exerted their ecological functions ^[2]. As a result of millions of years of evolution, the diversity of molecular structures and activities is immeasurable, with hidden functions and structures only recently disclosed by modern omics techniques associated with classical pharmacological studies ^[3]. Thus, the holistic molecular genetic analyses of venomous animals utilizing, for example, transcriptome in combination with proteome studies of venom glands, have revealed not only the diversity of a set of substances produced by a given organism that inhabits a particular biome but also the uniqueness of such molecular repertoire expressed as active components of biological materials, such as venoms ^[4]^[5]^[6]^[7]^[8].

Although marine and terrestrial biological reservoirs of active venom peptides appear crucial sources for drug discovery, examples of basic and applied research should be provided to attract the attention of the scientific community both in academia and industry. Fundamental research, development and innovation of venom components as diagnostics, therapeutics or both are not always an obvious issue for consideration for the general audience. Furthermore, molecular diversity is intrinsically related to biodiversity and pharmaceutical success in drug discovery from nature is dependent on the abundance and variety of biological resources, thus highlighting arguments for policies of environmental conservation and economic sustainability worldwide ^[9].

A particular class of molecules from animal venom that has been under constant focus comprises biologically active (bioactive) peptides. Owing to their selectivity for corresponding cell receptors and target specificity, as well as the relative structural stability in body fluids and amenability to be genetically and synthetically engineered, natural venom peptides are promising scaffolds for conversion into biopharmaceuticals (biotherapeutics), as exemplified by cysteine-stabilized and linear helical peptides ^[10]^[11]^[12]. In this review, I discussed natural peptides from animal venom and their derivatives possessing intrinsic properties such as interaction with biomembranes of target cells, access to the cytoplasm through membrane translocation and eventual accumulation in distinct organelles such as the nucleus and mitochondria. This class of special peptides, collectively called cell-penetrating peptides (CPPs), comprise full sequences, peptide segments or patches of large proteins and even encrypted subcellular localization signals, as well as rationally designed peptide chimeras, cyclic, stapled, dimeric, multivalent and self-assembled peptides and peptoid foldamers ^[13]^[14]^[15].

In the field of toxicology, membrane translocation and cell-penetration capabilities are well-recognized phenomena mainly associated with microbial and plant toxins, such as binary bacterial toxins (e.g., diphtheria toxin, Shiga toxin and cholera toxin) and plant ribosome inhibitor proteins (e.g., ricin and abrin), which bind to their respective receptors on the eukaryotic cytoplasmic membrane and enter cells by receptor-mediated endocytosis ^[16]^[17]^[18]. Less common but with a steeply increasing number of reports published over the years, animal toxins and venom peptides endowed with intrinsic properties of membrane permeation and cell internalization are currently being unraveled. These venom CPPs and derivatives, recapitulated herein, mechanistically penetrate cells by distinct pathways that involve receptor-dependent and/or receptor-independent endocytosis (non-disruptive peptides) or direct translocation through pore formation, followed by cellular uptake and intracellular compartmentalization (disruptive peptides). Hence, in this review, I collated current examples of cell-penetrating peptides derived from animal venoms and toxins, their basic research and advanced applications.

Cell-penetrating peptides (CPPs) consist of short sequences that range from few amino acids to less than 40 residues, which owing to their physicochemical and biological properties can cross lipid membranes of cells and intracellularly transport diverse types of molecular cargoes in the form of covalent conjugates or noncovalent complexes. The first CPP sequences were characterized and derived from the transactivator of transcription from HIV-1 (Tat protein), the antennapedia (Antp) homeodomain from Drosophila and VP22 from Herpes simplex virus type I, almost three decades ago. For instance, CPPs such as Tat^48–60 (residues 48–60, GRKKRRQRRRPPQ) and penetratin (Antp^43–58, RQIKIWFQNRRMKWKK), which are short-derived fragments from TAT protein and Drosophila Antp, respectively, were able to translocate across the plasma membrane of eukaryotic cells and set the stage for the development of a new class of non-viral vectors for the intracellular delivery of compounds and, therefore, converted into archetypal CPPs ^[19]^[20]. Since these initial discoveries, the field of CPPs has expanded into a prolific field of research. Databases of curated information about experimentally characterized CPPs and algorithms to predict CPPs have been created, along with the expansion of the field of CPPs ^[21]^[22]^[23]^[24]. It has become evident that CPPs are mostly linear sequences but cyclic sequences have also been detected and developed. They are usually composed of positively charged amino acids with or without distributed hydrophobic residues, conferring these peptide structures with a variable but a considerable level of amphipathic and cationicity and high affinity for negatively charged lipid membranes and their components, including phospholipids and proteoglycans. In particular, in the case of linear CPPs, studies investigating the relationship between CPP secondary structures and penetrability have demonstrated that cationic helical peptides possess superior cell permeation than amphipathic helical and amphipathic random peptides, as revealed through synthetic polyarginine CPPs stabilized with different proportion of α-aminoisobutyric acid ^[25]. Nevertheless, unstructured peptides in solution eventually form helices upon interaction with plasma membranes, promoting their efficient membrane insertion, translocation and cellular uptake ^[26]. Hydrophobic interaction followed by membrane insertion also plays a role in the cell penetration property demonstrated by some amphipathic CPPs ^[27]. Importantly, from the perspective of applications in biomedicine and pharmaceutical biotechnology, CPPs can simultaneously mediate the intracellular delivery of diverse molecular cargos, along with the membrane-crossing activity. These molecular cargoes include hydrophilic drugs, radionuclides, imaging agents (fluorescent dyes), biopolymers (nucleic acids, polypeptides), functionalized liposomes and nanoparticles (nanocrystals, light-sensitive and magnetic nanoparticles). Therefore, CPPs have attracted considerable attention not only for their application as vectors for drug delivery but also as agents for diagnostics and therapy (theranostics) in medicine ^[28]^[29]^[30]^[31].

Regarding their mechanistic of cell penetrability, although not conclusively elucidated, it has been shown that CPPs traverse hydrophobic membranes and enter into cells through distinct routes, relying on both membrane-disruptive and non-disruptive processes, this later comprising energy-dependent, receptor-mediated and receptor-independent endocytosis, as well as energy independent, direct translocation strategies. Hence, pathways for CPP entry into cells involve: (I) non-disruptive endocytic routes, such as clathrin-mediated endocytosis, caveolae-mediated uptake, clathrin/caveolae-independent endocytosis and micropinocytosis; (II) non-disruptive membrane, direct translocation by alternative routes, like inverted micelle formation and “carpet” model penetration; (III) direct translocation by membrane-disruptive routes, such as pore-formation (toroid and barrel-stave pores) and electroporation-like permeabilization. Moreover, based on experimental evidence with numerous known CPPs, more than a single pathway of membrane permeation and cellular internalization may be involved, depending on the CPP physicochemical features, effective concentrations (i.e., the peptide-to-cell ratio) and targeted cell types ^[19]^[20]^[32]. Although distinct pathways are involved in membrane translocation and internalization of several distinct CPPs investigated, the mode of membrane interaction, the efficacy of CPP-mediated cargo-dependent transport, subcellular compartmentalization and eventual adverse cytotoxic effects, depend not only on their own CPP structures but also on the position and nature of the molecular cargoes and the types of cell targets, as observed with CPPs that were conjugated with fluorescent dyes and polypeptides ^[32]^[33]^[34]^[35]^[36].

2. Cell-Penetrating Peptides from Animal Venoms and Toxins

To date, native venom peptides with cell-penetrating properties have been identified in a limited number of species of insects (bees and wasps), arachnids (spiders and scorpions), fish, amphibians and snakes (elapids and pit vipers). These CPPs have dual or multiple biological activities and are derived from the venoms or skin secretions, which are toxigenic, cytotoxic or antimicrobials. These venom CPPs include melittin from the honeybee, anoplin and mastoparans from wasps, latarcin and lycosin from spiders, chlorotoxin, maurocalcine and imperatoxin from scorpions, cardiotoxin, crotamine, crotalicidin and elapid cathelicidin-related antimicrobial peptides (CRAMPs) from snakes, pardaxin from fish skin and bombesin from frog skin (Table 1).

Table 1. Poisonous and venomous organisms that produce toxins with cell penetrability that originate cell-penetrating peptides

Scientific name	Common name	Toxin or toxin template	Obs.
Insects			Table 2, below
Apis mellifera	European honey bee	Melittin
Anoplius samariensis	Japanese solitary wasp	Anoplin
Vespula lewisii	Korean leather-jacket	Mastoparan

Arachnids			Table 3
Lachesana tarabevi	Central Asian spider	Latarcin-1
Lycosa singorensis	Wolf spider	Lycosin-1
Leiurus quinquestriatus	Israeli yellow scorpion	Chlorotoxin
Scorpio maurus palmatus	Tunisian scorpion	Maurocalcine
Pandinus imperator	African scorpion	Imperatoxin-A
Hadrurus gertschi	Mexican scorpion	Hadrucalcin
Urodacus manicatus	Australian Black Rock scorpion	Wasabi receptor toxin

Fish
Pardachirus sp	Mole sole fishes	Pardaxin	Table 4

Amphibian			Table 4
Bombina bombina	European fire-bellied toad	Bombesin

Snakes			Table 4
Crotalus durissus terrificus	South American rattlesnake	crotamine
		crotalicidin
Naja sp	Cobras	Cardiotoxin

The importance of this class of bioactive peptides relies on the fact that venom peptides and toxins, as well as related sequences, have evolved for millions of years of natural history and can be considered crucial improvements in peptide design that efficiently performs their functions. Importantly, native animal venom peptides and toxins with cell-penetrating activity have been characterized and CPPs derived from them conceived through a variety of structural modifications of their native sequences. These structural modifications of cell-penetrating venom peptides include peptide downsizing, amino acid residue replacement, structural stabilization and production of chimeras, which mostly reduced peptide cytotoxicity, maintained the target selectivity and enhanced the cellular penetrability and the capacity of intracellular cargo transport and delivery.

Tables 2 to 4 summarize examples of known venom peptides, toxins and derivatives with cell-penetrating properties, their overall structures, mode of cell entry, and conveyed compounds.

Table 2. Examples of peptides from insect (honey bee and wasp) venom and derivatives with cell-penetrating property.

Peptide	Sequence ^a	Size	Major Structural Features ^b	Mechanism(s) of Cell Penetration ^c	Cargo Delivery ^d	Ref.
Honey bee
Mellitin (MEL)	GIGAVLKVLTTGLPALISWIKRKRQQ-NH2	26	Amphipathic α-helix	DT, PF	FD	[49]
Tat/CM18 hybrid			Chimera	DT, MD, ND	CI	[52]
MEL-d(KLAKLAK)₂	GIGAVLKVLTTGLPALISWIKRKRQQGGGGS-d[KLAKLAKKLAKLAK]	45	Chimera	DT (?)	AP	[53]
p5RHH	VLTTGLPALISWIRRRHRRHC	21	C-terminal fragment	Endocytosis (?)	DNA polyplexes	[54,55]
p5RWR	VLTTGLPALISWIKRKRQQRWRRRR	25	C-terminal fragment	Endocytosis (?)	DNA polyplexes	[54,55]
MT20	GIGAVLKVLTTGLPALISWI	20	Hydrophobic helix	DT, MD	DNA polyplexes	[56]
FL20	GIGAILKVLATGLPTLISWI	20	Hydrophobic helix	DT, MD	DNA polyplexes	[56]
Melittin [1–14]	GIGAVLKVLTTGLP	14	N-terminal fragment	DT	NC, LP	[57]

Wasp
Anoplin	GLLKRIKTLL-NH₂	10	Amphipathic α-helix	DT, PF	FD	[60]
Anoplin dimer	(GLLKRIKTLL-NH₂)₂	20	C-N terminal dimer	DT, PF	-	[61]
Mastoparan	INLKALAALAKKIL-NH₂	14	Amphipathic α-helix	DT, PF	-	[64]
Mastoparan-X	INWKGIAAMAKKLL-NH₂	14	Amphipathic α-helix	DT, PF	-	[65]
Transportan	GWTLNSAGYLLGKINLKALAALAKKIL-NH₂	27	Chimera	multiple	CI	[66]
TP10	AGYLLGKINLKALAALAKKIL-NH₂	21	Shorter transportan	multiple	CI	[70,77]
TP10-5	AGYLLGKINLKKLAKL(Aib)KKIL-NH₂	21	Helical stabilized	DT	FD	[71]
Transportan 9dR	GWTLNSAGYLLGKINLKALAALAKKIL(dR)9	36	Chimera	Endocytosis (?)	siRNA	[73]
Mitoparan	INLKKLAKL(Aib)KKIL-NH₂	14	Mastoparan analog	DT	FD, AP	[78–80]

Notes: ^a-NH_2,amidated peptide; anoplin C-N terminal dimer, as prepared by intermolecular triazole bridge; Aib, α-aminoisobutyric acid; ^bParticular structural characteristics of native, designed or analogous peptides; C-N terminal dimer, intermolecular dimerization involving the carboxyl-terminus of one peptide and the amino-terminus of the other; ^cDT, direct translocation; PF, pore-forming; MD, membrane-disruptive cell uptake; NR, non-disruptive penetration; RM, receptor-mediated endocytosis; HI, hydrophobic insertion; multiple, more than a single mechanism of cell entry, that can involve direct translocation and endocytosis; ^dFD, fluorescent dyes; CI, diverse types of cell impermeant cargoes; AP, apoptotic peptides; NC, nanocrystals; LP, large proteins; RD, radionuclides; EZ, enzymes; IR, infrared; “-,” not applicable.

Table 3. Examples of peptides and derivatives from arachnid venoms with cell-penetrating and cargo delivery capacity.

Peptide	Sequence	Size	Major structural features	Mechanism(s) of cell Penetration	Cargo delivery	Ref.
Spider
Latarcin-1 (Ltc1)	SMWSGMWRRKLKKLRNALKKKLKGE	25	cationic α-helix	DT, PF	FD	[81]
Ltc1-decapeptide (LDP)	KWRRKLKKLR	10	Designed	DT	FD	[82]
LDP-NLS	KWRRKLKKLRPKKKRKV	17	Chimera	ED	FD, EZ	[83]
Lycosin-I	RKGWFKAMKSIAKFIAKEKLKEHL	24	Amphipathic α-helix	DT, ND	FD, NP	[87,88]
R-lycosin-I	Ac-RGWFRAMRSIARFIARERLREHL-amide	24	Lys-->Arg analog	ED	FD	[89]

Scorpion
Chlorotoxin (CTX)	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR	36	ICKfold/knottin	ED	FD, RD	[91–93]
[K15R/K23R]CTX	MCMPCFTTDHQMARRCDDCCGGRGRGKCYGPQCLCR	36	Mutant analog	ED	FD	[95]
[K15R/K23R/Y29W]CTX	MCMPCFTTDHQMARRCDDCCGGRGRGKCWGPQCLCR	36	Mutant analog	ED	FD	[95]
Maurocalcine (MCa)	GDCLPHLKLCKENKDCCSKKCKRRGTNIEKRCR	33	ICK fold/knottin	DT, ND	CI, NP	[99–101]
MCaUF1–9-C	GDAbuLPHLKLC	10	Truncated, unfold	DT	FD	[105]
Imperatoxin A (IpTxa)	GDCLPHLKRCKADNDCCGKKCKRRGTNAEKRCR	33	ICK fold/knottin	n	FD	[109]
Hadrucalcin (HdCa)	SEKDCIKHLQRCRENKDCCSKKCSRRGTNPEKRCR	35	ICK fold/knottin	DT, ND	-	[110]
HadUF₁₋₁₁(H11)	SEKDAbuIKHLQR-C	12	N-terminal fragment	DT, ND, ED (?)	NP	[111]
WaTx	ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS	33	CS-helical hairpin	DT, ND	FD	[112]

Notes: Ac, acetylated; -NH_2,amidated; Abu, Lys®Arg replacement; C-S, cysteine stabilized α-helix; DT, direct translocation; PF, pore-forming; ED, endocytosis; ND, non-disruptive penetration; RM, receptor-mediated endocytosis; HI, hydrophobic insertion; multiple, more than a single mechanism of cell entry, that can involve direct translocation and endocytosis; “n“, not informed; FD, fluorescent dyes; EZ, enzymes; NP, nanoparticles; RD, radionuclides; CI, diverse types of cell impermeant cargoes; “-“, not applicable.

Table 4. Examples of peptides and derivatives from fish and amphibian secretion and snake venom, with cell-penetrating and cargo delivery capacity.

Peptide	Sequence ^a	Size	Major Structural Features ^b	Mechanism(s) of Cell Penetration ^c	Cargo Delivery ^d	Ref.
Fish
Ac-Pardaxin P5	Ac-GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE	33	Hydrophobic helix	DT, PF	FD	[117]

Amphibian
bombesin	EQKLGNQWAVGHLM-NH₂	14	helical hairpin	RM	-	[118–120]
Tat-K3-bombesin^1-14	RKKRRQRRRGGCGEQKLGNQWAVGHLM-NH₂	27	Chimera	RM	RD	[124]

Snake
Crotamine	YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG	42	β-defensin fold	multiple	FD, CI	[138]
NrTP1	YKQCHKKGGKKGSG	14	N«C splice variant	multiple	FD	[146,147]
NrTP6	YKQSHKKGGKKGSG	14	NrTP1 CysDSer	multiple	FD, EZ	[148]
DY676-NrTP6	C-YKQSHKKGGKKGSG	15	Extra Cys		IR	[152]
CyLop-1	CRWRWKCCKK	10	Encrypted sequence	DT, ED	FD	[145]

Crotalicidin	KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF	34	Amphipathic α-helix	DT, PF	FD	[176]
Ctn[15–34]	KKRLKKIFKKPMVIGVTIPF-NH₂	20	C-terminal fragment	DT, PF	FD	[170,176]
cathelicidin- BF30	KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF	30	Shorter analog	DT, PF	-
Cardiotoxin	LKCNKLIPLAYKTCPAGKNLCYKMFMVSNKTVPVKRGCID ACPKNSLLVKYVCCNTDRCN	60	Three-finger fold	DT, HI	FD	[179]
PLA₂ C-terminal	KKYKAYFKFKCKK-NH₂	13	C-terminal fragment	DT, MD	-	[185]
PLA₂ fragment K®R	RRYRAYFRFRCRR-NH₂	13	Mutant K-->R	DT, MD	-	[185]
BPP-13a	<EGGWPRPGEIPP	12	Native	DT (?)	-	[187]
desPyr-BPP13a	GGWPRPGPEIPP	12	Mutant analog	DT (?)	FD	[187]

Notes: ^aAc, acetylated; -NH_2,amidated; <E, pyroglutamic; DT, direct translocation; ^bN«C, a spliced derivative of crotamine, comprising the N-terminal residues 1 to 9 and C-terminal 38 to 42 ([1–9] ~ [38–42]); NrTP6, an NrTP1 with a Cys-Ser replacement; DY676, near-infrared dye; ^cDT, direct translocation; PF, pore-forming; RM, receptor-mediated endocytosis; multiple, more than a single mechanism of cell entry, that can involve direct translocation and endocytosis; ED, endocytosis; HI, hydrophobic insertion; MD, membrane-disruptive cell uptake; ^dFD, fluorescent dyes; RD, radionuclides; EZ, enzymes; IR, infrared dye; “-“ not applicable;

These designed CPPs from venom peptides have found applications in biomedicine and biopharmaceutical biotechnology, in diagnostics to detect populations of diseased cells or tissues, in therapy to induce selective cell death through molecular delivery of cell-impermeant drugs, organic compounds, radionuclides and crystal, and metallic nanoparticles. The discoveries of cell-penetrating venom peptides and animal toxins will continue to contribute to the basic and applied research in this expanding field of CPPs derived from components of poisonous and venomous animals. The cell-penetrating venom peptides and toxin derivatives have expanded the library of animal toxins that act intracellularly and have presently served and will be useful in the future, for a variety of biomedical and biotechnological applications.

References

Singh, S.; Peláez, F. Biodiversity, chemical diversity and drug discovery. Prog. Drug Res. 2008, 65, 141, 143–174.
Nelsen, D.R.; Nisani, Z.; Cooper, A.M.; Fox, G.A.; Gren, E.C.; Corbit, A.G.; Hayes, W.K. Poisons, toxungens and venoms: Redefining and classifying toxic biological secretions and the organisms that employ them. Biol. Rev. Camb. Philos. Soc. 2014, 89, 450–465.
Modahl, C.M.; Brahma, R.K.; Koh, C.Y.; Shioi, N.; Kini, R.M. Omics Technologies for Profiling Toxin Diversity and Evolution in Snake Venom: Impacts on the Discovery of Therapeutic and Diagnostic Agents. Annu. Rev. Anim. Biosci. 2020, 8, 91–116.
Kazuma, K.; Masuko, K.; Konno, K.; Inagaki, H. Combined Venom Gland Transcriptomic and Venom Peptidomic Analysis of the Predatory Ant Odontomachus monticola. Toxins 2017, 9, 323.
Wiezel, G.A.; Shibao, P.Y.T.; Cologna, C.T.; Filho, M.R.; Vieira, U.C.; De Pauw, E.; Quinton, L.; Arantes, E.C. In-Depth Venome of the Brazilian Rattlesnake Crotalus durissus terrificus: An Integrative Approach Combining Its Venom Gland Transcriptome and Venom Proteome. J. Proteome Res. 2018, 17, 3941–3958.
Liao, Q.; Gong, G.; Poon, T.C.W.; Ang, I.L.; Lei, K.M.K.; Siu, S.W.I.; Wong, C.T.T.; Baptista, R.G.; Lee, S.M. Combined transcriptomic and proteomic analysis reveals a diversity of venom-related and toxin-like peptides expressed in the mat anemone Zoanthus natalensis (Cnidaria, Hexacorallia). Arch. Toxicol. 2019, 93, 1745–1767.
Carreto, R.S.; Estrella, V.R.; Bobadilla, P.T.; Navarro, L.A.; Sarabia, B.J.; Piñera, R.E.; Verleyen, J.J.; Rodríguez, E.; Almazán, R.C. Transcriptomic and Proteomic Analysis of the Tentacles and Mucus of Anthopleura dowii Verrill, 1869. Mar. Drugs 2019, 17, 436.
Aili, S.R.; Touchard, A.; Hayward, R.; Robinson, S.D.; Pineda, S.S.; Lalagüe, H.; Vetter, I.; Undheim, E.A.B.; Kini, R.M.; Escoubas, P.; et al. An Integrated Proteomic and Transcriptomic Analysis Reveals the Venom Complexity of the Bullet Ant Paraponera clavata. Toxins 2020, 12, 324.
Dalmazzone, S. Economics and Policy of Biodiversity Loss. In Sustainable Development and Environmental Management: Experiences and Case Studies; Clini, C., Musu, I., Gullino, M.L., Eds.; Springer: Dordrecht, The Netherlands, 2008; pp. 451–466.
Kessler, P.; Marchot, P.; Silva, M.; Servent, D. The three-finger toxin fold: A multifunctional structural scaffold able to modulate cholinergic functions. J. Neurochem. 2017, 142, 7–18.
Shafee, T.M.A.; Lay, F.T.; Phan, T.K.; Anderson, M.A.; Hulett, M.D. Convergent evolution of defensin sequence, structure and function. Cell. Mol. Life Sci. 2017, 74, 663–682.
Zhang, S.K.; Song, J.W.; Gong, F.; Li, S.B.; Chang, H.Y.; Xie, H.M.; Gao, H.W.; Tan, Y.X.; Ji, S.P. Design of an α-helical antimicrobial peptide with improved cell-selective and potent anti-biofilm activity. Sci. Rep. 2016, 6, 7394.
Joliot, A.; Prochiantz, A. Transduction peptides: From technology to physiology. Nat. Cell Biol. 2004, 6, 189–196.
Mándity, I.M.; Fülöp, F. An overview of peptide and peptoid foldamers in medicinal chemistry. Expert Opin. Drug Discov. 2015, 10, 1163–1177.
Kalafatovic, D.; Giralt, E. Cell-Penetrating Peptides: Design Strategies beyond Primary Structure and Amphipathicity. Molecules 2017, 22, 1929.
Sandvig, K.; van Deurs, B. Delivery into cells: Lessons learned from plant and bacterial toxins. Gene Ther. 2005, 12, 865–872.
Baptista, R.G.; Kerkis, A.; Silva, P.Á.R.; Hayashi, M.A.F.; Kerkis, I.; Tetsuo, Y. Membrane-translocating peptides and toxins: From nature to bedside. J. Braz. Chem. Soc. 2008, 19, 211–225.
Sandvig, K.; Bergan, J.; Kavaliauskiene, S.; Skotland, T. Lipid requirements for entry of protein toxins into cells. Prog. Lipid Res. 2014, 54, 1–13.
Bechara, C.; Sagan, S. Cell-penetrating peptides: 20years later, where do we stand? FEBS Lett. 2013, 587, 1693–1702.
Copolovici, D.M.; Langel, K.; Eriste, E.; Langel, Ü. Cell-Penetrating Peptides: Design, Synthesis and Applications. ACS Nano 2014, 8, 1972–1994.
Gautam, A.; Singh, H.; Tyagi, A.; Chaudhary, K.; Kumar, R.; Kapoor, P.; Raghava, G.P. CPPsite: A curated database of cell penetrating peptides. Database J. Biol. Databases Curation 2012, 2012.
Agrawal, P.; Bhalla, S.; Usmani, S.S.; Singh, S.; Chaudhary, K.; Raghava, G.P.; Gautam, A. CPPsite 2.0: A repository of experimentally validated cell-penetrating peptides. Nucleic Acids Res. 2016, 44, D1098–D1103.
Kardani, K.; Bolhassani, A. Cppsite 2.0: An Available Database of Experimentally Validated Cell-Penetrating Peptides Predicting their Secondary and Tertiary Structures. J. Mol. Biol. 2020, 6703.
Wei, H.H.; Yang, W.; Tang, H.; Lin, H. The Development of Machine Learning Methods in Cell-Penetrating Peptides Identification: A Brief Review. Curr. Drug Metab. 2019, 20, 217–223.
Yamashita, H.; Kato, T.; Oba, M.; Misawa, T.; Hattori, T.; Ohoka, N.; Tanaka, M.; Naito, M.; Kurihara, M.; Demizu, Y. Development of a Cell-penetrating Peptide that Exhibits Responsive Changes in its Secondary Structure in the Cellular Environment. Sci. Rep. 2016, 6.
Eiríksdóttir, E.; Konate, K.; Langel, Ü.; Divita, G.; Deshayes, S. Secondary structure of cell-penetrating peptides controls membrane interaction and insertion. Biochim. Biophys. Acta (BBA) Biomembr. 2010, 1798, 1119–1128.
Milletti, F. Cell-penetrating peptides: Classes, origin and current landscape. Drug Discov. Today 2012, 17, 850–860.
Borrelli, A.; Tornesello, A.L.; Tornesello, M.L.; Buonaguro, F.M. Cell Penetrating Peptides as Molecular Carriers for Anti-Cancer Agents. Molecules 2018, 23, 295.
Baptista, R.G.; Campelo, I.S.; Morlighem, J.R.L.; Melo, L.M.; Freitas, V.J.F. Cell-penetrating peptides (CPPs): From delivery of nucleic acids and antigens to transduction of engineered nucleases for application in transgenesis. J. Biotechnol. 2017, 252, 15–26.
Huang, Y.W.; Lee, H.J. 13-Cell-penetrating peptides for medical theranostics and targeted drug delivery. In Peptide Applications in Biomedicine, Biotechnology and Bioengineering; Koutsopoulos, S., Ed.; Woodhead Publishing: Cambridge, UK, 2018; pp. 359–370.
Pierantoni, G.M.; Paladino, S. Cell-penetrating peptides: Two faces of the same coin. Biochem. J. 2020, 477, 1363–1366.
Ruseska, I.; Zimmer, A. Internalization mechanisms of cell-penetrating peptides. Beilstein J. Nanotechnol. 2020, 11, 101–123.
Tünnemann, G.; Martin, R.M.; Haupt, S.; Patsch, C.; Edenhofer, F.; Cardoso, M.C. Cargo-dependent mode of uptake and bioavailability of TAT-containing proteins and peptides in living cells. FASEB J. Off. Publ. Fed. Am. Soc. Exp. Biol. 2006, 20, 1775–1784.
Andaloussi, E.S.; Järver, P.; Johansson, H.J.; Langel, U. Cargo-dependent cytotoxicity and delivery efficacy of cell-penetrating peptides: A comparative study. Biochem. J. 2007, 407, 285–292.
Hedegaard, S.F.; Derbas, M.S.; Lind, T.K.; Kasimova, M.R.; Christensen, M.V.; Michaelsen, M.H.; Campbell, R.A.; Jorgensen, L.; Franzyk, H.; Cárdenas, M.; et al. Fluorophore labeling of a cell-penetrating peptide significantly alters the mode and degree of biomembrane interaction. Sci. Rep. 2018, 8, 6327.
Patel, S.G.; Sayers, E.J.; He, L.; Narayan, R.; Williams, T.L.; Mills, E.M.; Allemann, R.K.; Luk, L.Y.P.; Jones, A.T.; Tsai, Y.H. Cell-penetrating peptide sequence and modification dependent uptake and subcellular distribution of green florescent protein in different cell lines. Sci. Rep. 2019, 9, 6298.

© Text is available under the terms and conditions of the Creative Commons Attribution (CC BY) license; additional terms may apply. By using this site, you agree to the Terms and Conditions and Privacy Policy.

Upload a video for this entry

Information

Subjects: Biochemistry & Molecular Biology

Contributor MDPI registered users' name will be linked to their SciProfiles pages. To register with us, please refer to https://encyclopedia.pub/register :

Gandhi Rádis-Baptista

View Times: 649

Entry Collection: Peptides for Health Benefits

Update Date: 12 Mar 2021

Table of Contents

Video Upload Options

Confirm

1. Introduction

2. Cell-Penetrating Peptides from Animal Venoms and Toxins

References