Bacterial resistance is an emergency public health problem worldwide, compounded by the ability of bacteria to form biofilms, mainly in seriously ill hospitalized patients. The World Health Organization has published a list of priority bacteria that should be studied and, in turn, has encouraged the development of new drugs.

| Peptide | Sequence and Properties | Antimicrobial Activity | Highlights | Reference |
|---|---|---|---|---|
| Myxinidin2 Myxinidin3 | KIKWILKYWKWS RIRWILRYWRWS | P. aeruginosa, S. aureus, and L. monocytogenes | Effects against a wide range of bacteria, with its mechanism of action based on its ability to insert into bacterial membranes to produce an ion channel or pore that disrupts membrane function. | [30] |
| Colistin (colistin–imipenem and colistin–ciprofloxacin) | ALYKKLLKKLLKSAKKLG | Pseudomonas aeruginosa, Escherichia coli and Klebsiella pneumoniae | Bactericidal mechanism by a detergent-like effect. Recommended as a last choice in the treatment of infections caused by MDR Gram-negative bacteria because it rarely causes bacterial resistance. | [31] |
| S4(1–16)M4Ka | ALWKTLLKKVLKAAAK-NH2 | P. fluorescens | Greater antimicrobial effect and less toxicity than its parent peptide (dermaseptin S4) | [32] |
| Pexiganan | GIGKFLKKAKKFGKAFVKILKK-NH2 | S. aureus, S. epidermidis, S. pyogenes, S. pneumoniae, E. coli and P. aeruginosa | Weak anti-biofilm agent against structures formed on CL. | [33] |
| Citropin 1.1 | GLFDVIKKVASVIGGL-NH2 | Potent anti-biofilm agent against S. aureus strains. | ||
| Temporin A: | FLPLIGRVLSGIL-NH2 | Strong activity against vancomycin-resistant strains. | ||
| Palm-KK-NH2 | Palm-KK-NH2 (Palm–hexadecanoic acid residue) | Effective against most strains in the form of a biofilm. Activity potentiated when combined with standard antibiotics. | ||
| Palm-RR-NH2 | Palm-RR-NH2 (Palm–hexadecanoic acid residue) | Efficiency potentiated when combined with standard antibiotics. | ||
| HB AMP | KKVVFWVKFK + HAp-binding heptapeptide (HBP7) | S. mutans, L. acidophilus and A. viscosus | Adsorption capacity on the dental surface. | [34] |
| KSLW | KKVVFWVKFK | Promising peptide for oral use as it is resistant to the gastrointestinal tract and stable in human saliva. | ||
| TiBP1-GGG-AMP | RPRENRGRERGKGGGLKLLKKLLKLLKKL | S. mutans, S. epidermidis, and E. coli. | Bifunctional peptide capable of binding to titanium materials, enabling its use in biomaterials. Antibacterial functionality. | [24] |
| BA250-C10 | RWRWRWK(C10) | P. aeruginosa | Great activity when used in synergism with two conventional anti-pseudomonas antibiotics to inhibit the planktonic growth of four strains of P. aeruginosa. | [35] |
| D-HB43 | FAKLLAKLAKKLL | Methicillin-resistant S. aureus strains | High cytotoxic and hemolytic effect. | [36] |
| D-Ranalexin | FLGGLIKIVPAMICAVTKKC | Methicillin-resistant S. aureus strains | Effective in dose-dependent biofilm killing, but high cytotoxic and hemolytic effect. | |
| FK13-a1 | WKRIVRRIKRWLR-NH2 | Methicillin-resistant S. aureus, MDR P. aeruginosa and vancomycin-resistant E. faecium | Mechanism of action based on the induction of cytoplasmic membrane potential loss, permeabilization, and rupture. | [37] |
| FK13-a7 | WKRWVRRWKRWLR-NH2 | Methicillin-resistant S. aureus, MDR P. aeruginosa and vancomycin-resistant E. faecium | Mechanism of action based on the induction of cytoplasmic membrane potential loss, permeabilization, and rupture. | |
| KR-12-a5 | KRIVKLILKWLR-NH2 | E. coli, P. aeruginosa, S. typhimurium, S. aureus, B. subtilis, S. epidermidis | This peptide and its analogs kill microbial cells by inducing loss of cytoplasmic membrane potential, permeabilization, and disruption. | [38] |
| AMP2 | KRRWRIWLV | E. coli, P. aeruginosa, S. aureus, E. faecalis, S. epidermidis | 76% reduction of the biofilm area. | [39] |
| GH12 | GLLWHLLHHLLH-NH2 | S. mutans | Antimicrobial activity against cariogenic bacteria and its biofilms in vitro. | [40] |
| TP4 | FIHHIIGGLFSAGKAIHRLIRRRRR | P. aeruginosa, K. pneumoniae, S. aureus | Peptide driven into helix shape by an LPS-like surfactant before binding to the target. | [41] |
| LyeTxI | IWLTALKFLGKNLGKHLALKQQLAKL | F. nucleatum, P. gingivalis, A. actinomycetemcomitans | Active against periodontopathic bacteria. Rapid bactericidal effect, prevention of biofilm development. Can be used in the dental field. | [42] |
| Esc(1–21) | GIFSKLAGKKIKNLLISGLKG-NH2 | P. aeruginosa | Mechanism of action causes membrane thinning. | [43] |
| L12 | LKKLLKKLLKKL-NH2 | P. aeruginosa, K. pneumoniae, S. aureus, E. coli | Mechanism of action based on pore formation, inducing rapid permeabilization of bacterial membranes, inhibition of biofilm formation, disruption of drug-resistant biofilms, and suppression of LPS-induced pro-inflammatory mediators, even at low peptide concentrations. | [44] |
| W12 | WKKWWKKWWKKW-NH2 | Suppression of LPS-induced pro-inflammatory mediators, even at low peptide concentrations. | ||
| WLBU2 | RRWVRRVRRVWRRVVRVVRRWVRR | E. faecium, S. aureus, K. pneumoniae, A. baumannii, P. aeruginosa and Enterobacter species | Mechanism of action based on preventing bacterial adhesion and interfering with gene expression. | [45][46] |
| LL37 | [LL-37, 37 aa] | E. faecium, S. aureus, K. pneumoniae, A. baumannii, P. aeruginosa and Enterobacter species | One of the most important human AMPs that play roles in the defense against local and systemic infections. Bactericidal mechanism against Gram-positive and Gram-negative bacteria based on phospholipid-dependent bacterial membrane disruption. | [45][47] |
| SAAP-148 | LKRVWKRVFKLLKRYWRQLKKPVR | E. faecium, S. aureus, K. pneumoniae, A. baumannii, P. aeruginosa and Enterobacter species | Promising peptide fights difficult-to-treat infections due to its broad antimicrobial activity against MDR, biofilm, and persistent bacteria. | [48] |
| WAM-1 | KRGFGKKLRKRLKKFRNSIKKRLKNFNVVIPIPLPG | A. baumannii | This peptide originates from LL37 AMPs and is more effective in inhibiting biofilm dispersion than its parent peptide. | [49] |
| H4 | KFKKLFKKLSPVIGKEFKRIVERIKRFLR | S. aureus, S. epidermidis, S. pneumoniae, E. coli, E. faecium, K. pneumoniae, and P. aeruginosa | Insignificant rates of toxicity to eukaryotic cells. | [50] |
| RWRWRWA-(Bpa) | RWRWRWA-(4-benzophenylalanine) | P. aeruginosa | It targets the bacterial lipid membrane, but there is no specific receptor. It only affects a range of cellular processes. | [51] |
| Pse-T2 | LNALKKVFQKIHEAIKLI-NH2 | P. aeruginosa, S. aureus, E. coli | Mechanism of action based on the ability to disrupt the outer and inner membrane of Gram-negative bacteria and to bind DNA. | [52] |
| Magainin 2 | GIGKFLHSAKKFGKAFVGEIMNS-NH2 | A. baumannii strains | Strong antibacterial activity against A. baumannii, including MDR strains. Non-toxic to mammalian cells. | [53] |
| Magainin I | GIGKFLHSAGKFGKAFVGEIMKS | E. coli strains | Demands more energy metabolism, translational processes, and bacterial defense in E. coli strains when present. | [54] |
| TC19 | LRCMCIKWWSGKHPK | B. subtilis strains | Promising peptide against Gram-positive bacteria, as its activity on the membrane interferes with several essential cellular processes, leading to bacterial death. | [55] |
| TC84 | LRAMCIKWWSGKHPK | Promising peptide against Gram-positive bacteria, as its activity on the membrane interferes with several essential cellular processes, leading to bacterial death. | ||
| BP2 | GKWKLFKKAFKKFLKILAC | B. subtilis strains | Promising peptide against Gram-positive bacteria, as its activity by perturbation of the membrane interferes with several essential cellular processes, leading to bacterial death. | [56] |
| Nisin A | MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCHCSIHVSK | B. subtilis spores | Application as an adjuvant to antibiotic peptides in providing a bactericidal coating for the spores. | [55][57] |
This entry is adapted from the peer-reviewed paper https://doi.org/10.3390/pharmaceutics14030642